TSPYL6 Antibody

Name TSPYL6 Antibody
Supplier Novus Biologicals
Catalog NBP1-52869
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TSPYL6 (TSPY-like 6) The peptide sequence was selected from the N terminal of TSPYL6. Peptide sequence MSLPESPHSPATLDYALEDPHQGQRSREKSKATEVMADMFDGRLEPIVFP.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene TSPYL6
Supplier Page Shop

Product images