Annexin 2 Receptor Antibody

Name Annexin 2 Receptor Antibody
Supplier Novus Biologicals
Catalog NBP1-53077
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C5ORF39 The peptide sequence was selected from the N terminal of C5ORF39 (NP_001014301). Peptide sequence EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ANXA2R
Conjugate Unconjugated
Supplier Page Shop

Product images