Name | Annexin 2 Receptor Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-53077 |
Prices | $329.00 |
Sizes | 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to C5ORF39 The peptide sequence was selected from the N terminal of C5ORF39 (NP_001014301). Peptide sequence EQHFLGCVKRAWDSAEVAPEPQPPPIVSSEDRGPWPLPLYPVLGEYSLDS. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | ANXA2R |
Conjugate | Unconjugated |
Supplier Page | Shop |