FBXO24 Antibody

Name FBXO24 Antibody
Supplier Novus Biologicals
Catalog NBP1-53140
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FBXO24(F-box protein 24) The peptide sequence was selected from the N terminal of FBXO24. Peptide sequence VCDGEGVWRRICRRLSPRLQDQDTKGLYFQAFGGRRRCLSKSVAPLLAHG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FBXO24
Conjugate Unconjugated
Supplier Page Shop

Product images