HUS1B Antibody
| Name | HUS1B Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-54582 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to HUS1B(HUS1 checkpoint homolog b (S. pombe)) The peptide sequence was selected from the N terminal of HUS1B. Peptide sequence ELFIHVSGTVARLAKVCVLRVRPDSLCFGPAGSGGLHEARLWCEVRQGAF. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | HUS1B |
| Supplier Page | Shop |
Product images
![Western Blot: HUS1B Antibody [NBP1-54582] - Human Liver cell lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/80_HUS1B%2520Antibody-Western%2520Blot-NBP1-54582-img0002.jpg)
Western Blot: HUS1B Antibody [NBP1-54582] - Human Liver cell lysate, concentration 0.2-1 ug/ml.