CLECL1 Antibody

Name CLECL1 Antibody
Supplier Novus Biologicals
Catalog NBP1-54397
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CLECL1(C-type lectin-like 1) The peptide sequence was selected from the middle region of CLECL1. Peptide sequence FSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAK.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene CLECL1
Supplier Page Shop

Product images