Name | CLECL1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-54397 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to CLECL1(C-type lectin-like 1) The peptide sequence was selected from the middle region of CLECL1. Peptide sequence FSLFLICAMAGDVVYADIKTVRTSPLELAFPLQRSVSFNFSTVHKSCPAK. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | CLECL1 |
Supplier Page | Shop |