GLYATL2 Antibody

Name GLYATL2 Antibody
Supplier Novus Biologicals
Catalog NBP1-54782
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to GLYATL2(glycine-N-acyltransferase-like 2) The peptide sequence was selected from the middle region of GLYATL2. Peptide sequence LDEAIRKVATSKSVQVDYMKTILFIPELPKKHKTSSNDKMELFEVDDDNK.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene GLYATL2
Supplier Page Shop

Product images