Name | TRIM60 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55076 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to TRIM60(tripartite motif-containing 60) The peptide sequence was selected from the N terminal of TRIM60. Peptide sequence LEGSLEPLRNNIERVEKVIILQGSKSVELKKKVEYKREEINSEFEQIRLF. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | TRIM60 |
Supplier Page | Shop |