TRIM60 Antibody

Name TRIM60 Antibody
Supplier Novus Biologicals
Catalog NBP1-55076
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TRIM60(tripartite motif-containing 60) The peptide sequence was selected from the N terminal of TRIM60. Peptide sequence LEGSLEPLRNNIERVEKVIILQGSKSVELKKKVEYKREEINSEFEQIRLF.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene TRIM60
Supplier Page Shop

Product images