TRIM43 Antibody

Name TRIM43 Antibody
Supplier Novus Biologicals
Catalog NBP1-55071
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TRIM43(tripartite motif-containing 43) The peptide sequence was selected from the C terminal of TRIM43. Peptide sequence NSTMVNSEDIFLLLCLKVDNHFNLLTTSPVFPHYIEKPLGRVGVFLDFES.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TRIM43
Conjugate Unconjugated
Supplier Page Shop

Product images