TRIM49 Antibody

Name TRIM49 Antibody
Supplier Novus Biologicals
Catalog NBP1-55061
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TRIM49(tripartite motif-containing 49) The peptide sequence was selected from the N terminal of TRIM49. Peptide sequence RPCFYLNWQDIPFLVQCSECTKSTEQINLKTNIHLKKMASLARKVSLWLF.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TRIM49
Conjugate Unconjugated
Supplier Page Shop

Product images