CSGLCAT Antibody
| Name | CSGLCAT Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55085 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to CSGLCA-T The peptide sequence was selected from the N terminal of CSGLCA-T. Peptide sequence SLLRVSWIQGEGEDPCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYY. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | CHPF2 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: CSGLCAT Antibody [NBP1-55085] - Titration: 0.2-1 ug/ml Positive Control: Human Liver.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/14814_CSGLCAT-Antibody-Western-Blot-NBP1-55085-img0004.jpg)
Western Blot: CSGLCAT Antibody [NBP1-55085] - Titration: 0.2-1 ug/ml Positive Control: Human Liver.