IPCEF1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-55367
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to PIP3-E(phosphoinositide-binding protein PIP3-E) The peptide sequence was selected from the middle region of PIP3-E. Peptide sequence IHKALENSFVTSESGFLNSLSSDDTSSLSSNHDHLTVPDKPAGSKIMDKE.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: IPCEF1
• Conjugate: Unconjugated