RPL24/RLP24 Antibody
| Name | RPL24/RLP24 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-55479 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C15ORF15 The peptide sequence was selected from the middle region of C15ORF15. Peptide sequence FIMNRLKKNKELQKVQDIKEVKQNIHLIRAPLAGKGKQLEEKMVQQLQED. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | RSL24D1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: RPL24/RLP24 Antibody [NBP1-55479] - 293T cells lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/17120_RPL24-RLP24-Antibody-Western-Blot-NBP1-55479-img0002.jpg)
Western Blot: RPL24/RLP24 Antibody [NBP1-55479] - 293T cells lysate, concentration 0.2-1 ug/ml.