FAM50B Antibody

Name FAM50B Antibody
Supplier Novus Biologicals
Catalog NBP1-55474
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FAM50B(family with sequence similarity 50, member B) The peptide sequence was selected from the N terminal of FAM50B. Peptide sequence EQRRERKRKISCLSFALDDLDDQADAAEARRAGNLGKNPDVDTSFLPDRD.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene FAM50B
Conjugate Unconjugated
Supplier Page Shop

Product images