SPATA16 Antibody

Name SPATA16 Antibody
Supplier Novus Biologicals
Catalog NBP1-55464
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SPATA16(spermatogenesis associated 16) The peptide sequence was selected from the N terminal of SPATA16. Peptide sequence MDAGSSRSLENAVNRIYHDQLVPKINTSKKMSTLAHPPNILEMSQEIKKN.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SPATA16
Supplier Page Shop

Product images