RD3 Antibody

Name RD3 Antibody
Supplier Novus Biologicals
Catalog NBP1-55461
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RD3(retinal degeneration 3) The peptide sequence was selected from the N terminal of RD3. Peptide sequence GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RD3
Conjugate Unconjugated
Supplier Page Shop

Product images