SPATA17 Antibody

Name SPATA17 Antibody
Supplier Novus Biologicals
Catalog NBP1-55371
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SPATA17(spermatogenesis associated 17) The peptide sequence was selected from the C terminal of SPATA17. Peptide sequence NMFLPFSSYHKNEKYIPSMHLSSKYGPISYKEQFRSENPKKWICDKDFQT.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SPATA17
Supplier Page Shop

Product images