Name | RNASE9 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55370 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to RNASE9(ribonuclease, RNase A family, 9 (non-active)) The peptide sequence was selected from the N terminal of RNASE9. Peptide sequence PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNH. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | RNASE9 |
Supplier Page | Shop |