RNASE9 Antibody

Name RNASE9 Antibody
Supplier Novus Biologicals
Catalog NBP1-55370
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to RNASE9(ribonuclease, RNase A family, 9 (non-active)) The peptide sequence was selected from the N terminal of RNASE9. Peptide sequence PEEDKKEEFEECLEKFFSTGPARPPTKEKVKRRVLIEPGMPLNHIEYCNH.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene RNASE9
Supplier Page Shop

Product images