Name | CDRT4 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-55440 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to CDRT4(CMT1A duplicated region transcript 4) The peptide sequence was selected from the middle region of CDRT4. Peptide sequence TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | CDRT4 |
Supplier Page | Shop |