CDRT4 Antibody

Name CDRT4 Antibody
Supplier Novus Biologicals
Catalog NBP1-55440
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CDRT4(CMT1A duplicated region transcript 4) The peptide sequence was selected from the middle region of CDRT4. Peptide sequence TSQTVKRLIEKSKTRELECMRALEERPWASRQNKPSSVIQPKRRKSSKSS.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene CDRT4
Supplier Page Shop

Product images