SH3BGR Antibody
| Name | SH3BGR Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-80550 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptide directed towards the N terminal of human SH3BGR. Peptide sequence CGDFDSFFSAKEENIIYSFLGLAPPPDSKGSEKAEEGGETEAQKEGSEDV. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | SH3BGR |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
![Western Blot: SH3BGR Antibody [NBP1-80550] - Blocking: 5% Milk Positive Control: human LCL and mouse brains](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6871_SH3BGR-Antibody-Western-Blot-NBP1-80550-img0005.jpg)
![Western Blot: SH3BGR Antibody [NBP1-80550] - HepG2 cell lysate, Antibody Titration: 0.2-1 ug/ml](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/6872_SH3BGR%2520Antibody-Western%2520Blot-NBP1-80550-img0002.jpg)