D4S234E Antibody

Name D4S234E Antibody
Supplier Novus Biologicals
Catalog NBP1-80544
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptide directed towards the N terminal of human D4S234E. Peptide sequence MVKLGNNFAEKGTKQPLLEDGFDTIPLMTPLDVNQLQFPPPDKVVVKTKT.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene NSG1
Supplier Page Shop

Product images