C1orf131 Antibody

Name C1orf131 Antibody
Supplier Novus Biologicals
Catalog NBP1-57829
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to C1ORF131 The peptide sequence was selected from the middle region of C1orf131. Peptide sequence TGPEILAAAVPPSSLKNNREQVEVVEFHSNKKRKLTPDHNKNTKQANPSV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene C1orf131
Conjugate Unconjugated
Supplier Page Shop

Product images