RMD1 Antibody

Name RMD1 Antibody
Supplier Novus Biologicals
Catalog NBP1-57839
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to FAM82B(family with sequence similarity 82, member B) The peptide sequence was selected from the N terminal of FAM82B. Peptide sequence MALAARLWRLLPFRRGAAPGSRLPAGTSGSRGHCGPCRFRGFEVMGNPGT.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene RMDN1
Conjugate Unconjugated
Supplier Page Shop

Product images