EVER2 Antibody

Name EVER2 Antibody
Supplier Novus Biologicals
Catalog NBP1-57812
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TMC8 (transmembrane channel-like 8) The peptide sequence was selected from the N terminal of TMC8)(50ug). Peptide sequence PGPTLNLTLQCPGSRQSPPGVLRFHNQLWHVLTGRAFTNTYLFYGAYRVG.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TMC8
Conjugate Unconjugated
Supplier Page Shop

Product images