PSG5 Antibody

Name PSG5 Antibody
Supplier Novus Biologicals
Catalog NBP1-57962
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PSG5(pregnancy specific beta-1-glycoprotein 5) The peptide sequence was selected from the middle region of PSG5. Peptide sequence SIPQITTKHRGLYTCSVRNSATGKESSKSMTVEVSAPSGIGRLPLLNPI.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PSG5
Conjugate Unconjugated
Supplier Page Shop

Product images