Cystatin S Antibody

Name Cystatin S Antibody
Supplier Novus Biologicals
Catalog NBP1-57919
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CST4(cystatin S) The peptide sequence was selected from the N terminal of CST4. Peptide sequence MARPLCTLLLLMATLAGALASSSKEENRIIPGGIYDADLNDEWVQRALHF.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene CST4
Conjugate Unconjugated
Supplier Page Shop

Product images