Plexin A4 Antibody

Name Plexin A4 Antibody
Supplier Novus Biologicals
Catalog NBP1-57947
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PLXNA4(plexin A4) The peptide sequence was selected from the middle region of PLXNA4. Peptide sequence TQEWIGVEGDPPGANIASQEQMLCVYLQCSSHKAISDQRVQPLLCCFLNV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene PLXNA4
Conjugate Unconjugated
Supplier Page Shop

Product images