STATH Antibody

Name STATH Antibody
Supplier Novus Biologicals
Catalog NBP1-58020
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to STATH(statherin) The peptide sequence was selected from the middle region of STATH. Peptide sequence MKFLVFAFILALMVSMIGADSSEEKFLRRIGRFGYGYGPYQPVPEQPLYP.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene STATH
Conjugate Unconjugated
Supplier Page Shop

Product images