TP53TG5 Antibody
| Name | TP53TG5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-58924 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to C20ORF10 The peptide sequence was selected from the middle region of C20ORF10. Peptide sequence TSLAAMPRKEKHIEPEVPRTSRDDSLNPGVQGRQPLTEGPRVIFIKPYRN. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | TP53TG5 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: TP53TG5 Antibody [NBP1-58924] - Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_10/16549_TP53TG5%2520Antibody-Western%2520Blot-NBP1-58924-img0003.jpg)
Western Blot: TP53TG5 Antibody [NBP1-58924] - Titration: 0.2-1 ug/ml, Positive Control: Transfected 293T.