Adenosine Deaminase 2/CECR1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59343
• Prices: $329.00
• Sizes: 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to CECR1(cat eye syndrome chromosome region, candidate 1) The peptide sequence was selected from the N terminal of CECR1. Peptide sequence MQFRFAHPTPRPSEKCSKWILLEDYRKRVQNVTEFDDSLLRNFTLVTQHP.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: CECR1
• Conjugate: Unconjugated