Name | MSH5 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-58154 |
Prices | $139.00, $329.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to MSH5(mutS homolog 5 (E. coli)) The peptide sequence was selected from the N terminal of MSH5. Peptide sequence KQRLLSGNYSFIPDAMTATEKILFLSSIIPFDCLLTPPGDLRFTPIPLLI. |
Purity/Format | Immunogen affinity purified |
Description | Rabbit Polyclonal |
Gene | MSH5 |
Conjugate | Unconjugated |
Supplier Page | Shop |