Name | PAGE1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-58313 |
Prices | $139.00, $299.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to PAGE1(P antigen family, member 1 (prostate associated)) The peptide sequence was selected from the middle region of PAGE1. Peptide sequence TKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQELGLPN. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | PAGE1 |
Conjugate | Unconjugated |
Supplier Page | Shop |