PAGE1 Antibody

Name PAGE1 Antibody
Supplier Novus Biologicals
Catalog NBP1-58313
Prices $139.00, $299.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to PAGE1(P antigen family, member 1 (prostate associated)) The peptide sequence was selected from the middle region of PAGE1. Peptide sequence TKRVCLRNEEQMKLPAEGPEPEADSQEQVHPKTGCERGDGPDVQELGLPN.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene PAGE1
Conjugate Unconjugated
Supplier Page Shop

Product images