DGK-epsilon Antibody

Name DGK-epsilon Antibody
Supplier Novus Biologicals
Catalog NBP1-59067
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to DGKE(diacylglycerol kinase, epsilon 64kDa) The peptide sequence was selected from the N terminal of DGKE. Peptide sequence EAERRPAPGSPSEGLFADGHLILWTLCSVLLPVFITFWCSLQRSRRQLHR.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene DGKE
Conjugate Unconjugated
Supplier Page Shop

Product images