SHISA5 Antibody

Name SHISA5 Antibody
Supplier Novus Biologicals
Catalog NBP1-59053
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SCOTIN The peptide sequence was selected from the middle region of SCOTIN. Peptide sequence CAVPEASVPASVEPVEQLGSALRFRPGYNDPMSGFGATLAVGLTIFVLSV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene SHISA5
Conjugate Unconjugated
Supplier Page Shop

Product images