TMEM75 Antibody

Name TMEM75 Antibody
Supplier Novus Biologicals
Catalog NBP1-59685
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TMEM75(transmembrane protein 75) The peptide sequence was selected from the C terminal of TMEM75. Peptide sequence VTISQDSETLSLDCDHRLFFSLPFTDPASGGQSQHSWPCPERSKNLPQVS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TMEM75
Conjugate Unconjugated
Supplier Page Shop

Product images