AGPAT2 Antibody

Name AGPAT2 Antibody
Supplier Novus Biologicals
Catalog NBP1-59734
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to AGPAT2(1-acylglycerol-3-phosphate O-acyltransferase 2 ) The peptide sequence was selected from the C terminal of AGPAT2. Peptide sequence LEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSGVQPA.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene AGPAT2
Conjugate Unconjugated
Supplier Page Shop

Product images

This product has images. Please go to Supplier's page for details.