SLCO6A1 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59898
• Prices: $139.00, $299.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SLCO6A1(solute carrier organic anion transporter family, member 6A1) The peptide sequence was selected from the N terminal of SLCO6A1. Peptide sequence CCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQKEYQLKTIEKLALEKS.
• Purity/Format: Protein A purified
• Description: Rabbit Polyclonal
• Gene: SLCO6A1
• Conjugate: Unconjugated