Name | SLCO6A1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59898 |
Prices | $139.00, $299.00 |
Sizes | 20 µl, 100 µl |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SLCO6A1(solute carrier organic anion transporter family, member 6A1) The peptide sequence was selected from the N terminal of SLCO6A1. Peptide sequence CCNNIRCFMIFYCILLICQGVVFGLIDVSIGDFQKEYQLKTIEKLALEKS. |
Purity/Format | Protein A purified |
Description | Rabbit Polyclonal |
Gene | SLCO6A1 |
Conjugate | Unconjugated |
Supplier Page | Shop |