OR6C68 Antibody

Name OR6C68 Antibody
Supplier Novus Biologicals
Catalog NBP1-59859
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to OR6C68(olfactory receptor, family 6, subfamily C, member 68) Antibody(against the N terminal of OR6C68. Peptide sequence MQKSVMRKHTAITTFILLGLTEDPQLQVLLFMFLFITYMLSVTGKLTIIA.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene OR6C68
Supplier Page Shop

Product images