ITFG3 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-59854
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to ITFG3 (integrin alpha FG-GAP repeat containing 3) The peptide sequence was selected from the middle region of ITFG3)(50ug). Peptide sequence RSAFFFWGLHELGSTSETETGEARHSLYMFHPTLPRVLLELANVSTHIVA.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: ITFG3
• Conjugate: Unconjugated