SECTM1 Antibody

Name SECTM1 Antibody
Supplier Novus Biologicals
Catalog NBP1-59846
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SECTM1 (secreted and transmembrane 1) The peptide sequence was selected from the middle region of SECTM1)(50ug). Peptide sequence ARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAV.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SECTM1
Supplier Page Shop

Product images