Name | SECTM1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-59846 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SECTM1 (secreted and transmembrane 1) The peptide sequence was selected from the middle region of SECTM1)(50ug). Peptide sequence ARDSHAGLYMWHLVGHQRNNRQVTLEVSGAEPQSAPDTGFWPVPAVVTAV. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | SECTM1 |
Supplier Page | Shop |