SGLT3/SLC5A4 Antibody

Name SGLT3/SLC5A4 Antibody
Supplier Novus Biologicals
Catalog NBP1-59886
Prices $299.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC5A4(solute carrier family 5 (low affinity glucose cotransporter), member 4) (NP_055042). The peptide sequence was selected from the N terminal of SLC5A4. Peptide sequence MASTVSPSTIAETPEPPPLSDHIRNAADISVIVIYFLVVMAV
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene SLC5A4
Conjugate Unconjugated
Supplier Page Shop

Product images