OR2W5 Antibody
| Name | OR2W5 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-59860 |
| Prices | $369.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to OR2W5(olfactory receptor, family 2, subfamily W, member 5) The peptide sequence was selected from the middle region of OR2W5. Peptide sequence SGEVPDSLLHHRHSQHQPPHLHFEEQGCEGDHEETSGVGERGWGASTRGT. |
| Purity/Format | Peptide affinity purified |
| Description | Rabbit Polyclonal |
| Gene | OR2W5 |
| Supplier Page | Shop |
Product images
![Western Blot: OR2W5 Antibody [NBP1-59860] - Human Small Intestine, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_5/200_OR2W5%2520Antibody-Western%2520Blot-NBP1-59860-img0002.jpg)
Western Blot: OR2W5 Antibody [NBP1-59860] - Human Small Intestine, concentration 0.2-1 ug/ml.