LMF1 Antibody

Name LMF1 Antibody
Supplier Novus Biologicals
Catalog NBP1-62445
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to LMF1(lipase maturation factor 1) The peptide sequence was selected from the N terminal of LMF1 (NP_073610). Peptide sequence MRPDSPTMAAPAESLRRRKTGYSDPEPESPPAPGRGPAGSPAHLHTGTFW.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene LMF1
Conjugate Unconjugated
Supplier Page Shop

Product images