CYP4F12 Antibody

Name CYP4F12 Antibody
Supplier Novus Biologicals
Catalog NBP1-62384
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CYP4F12(cytochrome P450, family 4, subfamily F, polypeptide 12) The peptide sequence was selected from the middle region of CYP4F12. Peptide sequence DGRRFHRACRLVHDFTDAVIRERRRTLPTQGIDDFFKDKAKSKTLDFIDV.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene CYP4F12
Conjugate Unconjugated
Supplier Page Shop

Product images