Name | CYP4X1 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-62382 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to CYP4X1(cytochrome P450, family 4, subfamily X, polypeptide 1) The peptide sequence was selected from the middle region of CYP4X1. Peptide sequence LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | CYP4X1 |
Supplier Page | Shop |