CYP4X1 Antibody

Name CYP4X1 Antibody
Supplier Novus Biologicals
Catalog NBP1-62382
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to CYP4X1(cytochrome P450, family 4, subfamily X, polypeptide 1) The peptide sequence was selected from the middle region of CYP4X1. Peptide sequence LDIVLSAKDESGSSFSDIDVHSEVSTFLLAGHDTLAASISWILYCLALNP.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene CYP4X1
Supplier Page Shop

Product images