BTN2A1 Antibody
| Name | BTN2A1 Antibody |
|---|---|
| Supplier | Novus Biologicals |
| Catalog | NBP1-62371 |
| Prices | $139.00, $329.00 |
| Sizes | 20 µl, 100 µl |
| Host | Rabbit |
| Clonality | Polyclonal |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | Synthetic peptides corresponding to BTN2A1(butyrophilin, subfamily 2, member A1) The peptide sequence was selected from the N terminal of BTN2A1. Peptide sequence SVALVIHNITAQENGTYRCYFQEGRSYDEAILHLVVAGLGSKPLISMRGH. |
| Purity/Format | Immunogen affinity purified |
| Description | Rabbit Polyclonal |
| Gene | BTN2A1 |
| Conjugate | Unconjugated |
| Supplier Page | Shop |
Product images
![Western Blot: BTN2A1 Antibody [NBP1-62371] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19857_BTN2A1-Antibody-Western-Blot-NBP1-62371-img0004.jpg)
Western Blot: BTN2A1 Antibody [NBP1-62371] - Human Fetal Heart, Antibody Dilution: 1.0 ug/ml.
![Western Blot: BTN2A1 Antibody [NBP1-62371] - Human Thymus lysate, concentration 0.2-1 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19858_BTN2A1-Antibody-Western-Blot-NBP1-62371-img0002.jpg)
Western Blot: BTN2A1 Antibody [NBP1-62371] - Human Thymus lysate, concentration 0.2-1 ug/ml.
![Western Blot: BTN2A1 Antibody [NBP1-62371] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19859_BTN2A1-Antibody-Western-Blot-NBP1-62371-img0003.jpg)
Western Blot: BTN2A1 Antibody [NBP1-62371] - Human Adult Placenta, Antibody Dilution: 1.0 ug/ml.
![Western Blot: BTN2A1 Antibody [NBP1-62371] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.](http://www.bioprodhub.com/system/product_images/ab_products/5/sub_8/19860_BTN2A1%2520Antibody-Western%2520Blot-NBP1-62371-img0005.jpg)
Western Blot: BTN2A1 Antibody [NBP1-62371] - Human Fetal Lung, Antibody Dilution: 1.0 ug/ml.