ACPT Antibody

Name ACPT Antibody
Supplier Novus Biologicals
Catalog NBP1-62440
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ACPT(acid phosphatase, testicular) The peptide sequence was selected from the middle region of ACPT (NP_149059). Peptide sequence TLLALQGALGLYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRND.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ACPT
Conjugate Unconjugated
Supplier Page Shop

Product images