Name | SLC22A15 Antibody |
---|---|
Supplier | Novus Biologicals |
Catalog | NBP1-62420 |
Prices | $369.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Applications | WB |
Species Reactivities | Human |
Antigen | Synthetic peptides corresponding to SLC22A15(solute carrier family 22, member 15) The peptide sequence was selected from the middle region of SLC22A15. Peptide sequence NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK. |
Purity/Format | Peptide affinity purified |
Description | Rabbit Polyclonal |
Gene | SLC22A15 |
Supplier Page | Shop |