SLC22A15 Antibody

Name SLC22A15 Antibody
Supplier Novus Biologicals
Catalog NBP1-62420
Prices $369.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to SLC22A15(solute carrier family 22, member 15) The peptide sequence was selected from the middle region of SLC22A15. Peptide sequence NQKWFGRKRTLSAFLCLGGLACLIVMFLPEKKDTGVFAVVNSHSLSLLGK.
Purity/Format Peptide affinity purified
Description Rabbit Polyclonal
Gene SLC22A15
Supplier Page Shop

Product images