SLC39A12 Antibody

• Supplier: Novus Biologicals
• Catalog: NBP1-62528
• Prices: $139.00, $329.00
• Sizes: 20 µl, 100 µl
• Host: Rabbit
• Clonality: Polyclonal
• Isotype: IgG
• Applications: WB
• Species Reactivities: Human
• Antigen: Synthetic peptides corresponding to SLC39A12(solute carrier family 39 (zinc transporter), member 12) The peptide sequence was selected from the N terminal of SLC39A12. Peptide sequence MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL.
• Purity/Format: Immunogen affinity purified
• Description: Rabbit Polyclonal
• Gene: SLC39A12
• Conjugate: Unconjugated