ARSE Antibody

Name ARSE Antibody
Supplier Novus Biologicals
Catalog NBP1-62667
Prices $329.00
Sizes 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to ARSE(arylsulfatase E (chondrodysplasia punctata 1)) The peptide sequence was selected from the middle region of ARSE. Peptide sequence KVVHHDPPLLFDLSRDPSETHILTPASEPVFYQVMERVQQAVWEHQRTLS.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene ARSE
Conjugate Unconjugated
Supplier Page Shop

Product images