TRAM1L1 Antibody

Name TRAM1L1 Antibody
Supplier Novus Biologicals
Catalog NBP1-60111
Prices $139.00, $329.00
Sizes 20 µl, 100 µl
Host Rabbit
Clonality Polyclonal
Applications WB
Species Reactivities Human
Antigen Synthetic peptides corresponding to TRAM1L1(translocation associated membrane protein 1-like 1) The peptide sequence was selected from the middle region of TRAM1L1. Peptide sequence LWAIVFILGRLVTLIVSVLTVGFHLAGSQNRNPDALTGNVNVLAAKIAVL.
Purity/Format Immunogen affinity purified
Description Rabbit Polyclonal
Gene TRAM1L1
Conjugate Unconjugated
Supplier Page Shop

Product images